RegulonDB RegulonDB 10.9: Amino acid Sequence
cytochrome bo3 ubiquinol oxidase subunit 4 Amino Acid Sequence


Size: 109

Fasta

 

>cytochrome bo3 ubiquinol oxidase subunit 4 E. coli K12. Version NC_000913.3 GI:556503834
MSHSTDHSGASHGSVKTYMTGFILSIILTVIPFWMVMTGAASPAVILGTILAMAVVQVLV
HLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMMMH
              
                            

Download fasta file
RegulonDB