RegulonDB RegulonDB 10.9: Amino acid Sequence
sulfate/thiosulfate ABC transporter inner membrane subunit CysW Amino Acid Sequence


Size: 291

Fasta

 

>sulfate/thiosulfate ABC transporter inner membrane subunit CysW E. coli K12. Version NC_000913.3 GI:556503834
MAEVTQLKRYDARPINWGKWFLIGIGMLVSAFILLVPMIYIFVQAFSKGLMPVLQNLADP
DMLHAIWLTVMIALIAVPVNLVFGILLAWLVTRFNFPGRQLLLTLLDIPFAVSPVVAGLV
YLLFYGSNGPLGGWLDEHNLQIMFSWPGMVLVTIFVTCPFVVRELVPVMLSQGSQEDEAA
ILLGASGWQMFRRVTLPNIRWALLYGVVLTNARAIGEFGAVSVVSGSIRGETLSLPLQIE
LLEQDYNTVGSFTAAALLTLMAIITLFLKSMLQWRLENQEKRAQQEEHHEH
              
                            

Download fasta file
RegulonDB