RegulonDB RegulonDB 10.9: Amino acid Sequence
succinyl-diaminopimelate desuccinylase Amino Acid Sequence


Size: 375

Fasta

 

>succinyl-diaminopimelate desuccinylase E. coli K12. Version NC_000913.3 GI:556503834
MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQNFWAWRGQGET
LAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAQHPN
HTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVKNGRRGS
LTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIANIQAGT
GSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKHQLRYTVDWWLSGQPFLTARGKL
VDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINECVNAADLQ
LLARMYQRIMEQLVA
              
                            

Download fasta file
RegulonDB