RegulonDB RegulonDB 10.9: Amino acid Sequence
acetyl-CoA carboxyltransferase subunit β Amino Acid Sequence


Size: 304

Fasta

 

>acetyl-CoA carboxyltransferase subunit β E. coli K12. Version NC_000913.3 GI:556503834
MSWIERIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNR
LHSLLDEGSLVELGSELEPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPV
VAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKT
SAALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTVREK
LPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKLMNLPAPNPEAPREGVVVPPVPDQ
EPEA
              
                            

Download fasta file
RegulonDB