RegulonDB RegulonDB 10.9: Amino acid Sequence
deoxyribose-phosphate aldolase Amino Acid Sequence


Size: 259

Fasta

 

>deoxyribose-phosphate aldolase E. coli K12. Version NC_000913.3 GI:556503834
MTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTL
KEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFD
LVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPE
SARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSL
LASLLKALGHGDGKSASSY
              
                            

Download fasta file
RegulonDB