RegulonDB RegulonDB 10.9: Amino acid Sequence
DNA-binding transcriptional dual regulator DicA Amino Acid Sequence


Size: 135

Fasta

 

>DNA-binding transcriptional dual regulator DicA E. coli K12. Version NC_000913.3 GI:556503834
METKNLTIGERIRYRRKNLKHTQRSLAKALKISHVSVSQWERGDSEPTGKNLFALSKVLQ
CSPTWILFGDEDKQPTPPVEKPVALSPKELELLELFNALPESEQDTQLAEMRARVKNFNK
LFEELLKARQRTNKR
              
                            

Download fasta file
RegulonDB