RegulonDB RegulonDB 10.9: Amino acid Sequence
Qin prophage; putative DNA-binding transcriptional regulator DicC Amino Acid Sequence


Size: 76

Fasta

 

>Qin prophage; DNA-binding transcriptional regulator for DicB E. coli K12. Version NC_000913.3 GI:556503834
MLKTDALLYFGSKTKLAQAAGIRLASLYSWKGDLVPEGRAMRLQEASGGELQYDPKVYDE
YRKTKRAGRLNNENHS
              
                            

Download fasta file
RegulonDB