RegulonDB RegulonDB 10.9: Amino acid Sequence
DNA replication protein DnaC Amino Acid Sequence


Size: 245

Fasta

 

>DNA replication protein DnaC E. coli K12. Version NC_000913.3 GI:556503834
MKNVGDLMQRLQKMMPAHIKPAFKTGEELLAWQKEQGAIRSAALERENRAMKMQRTFNRS
GIRPLHQNCSFENYRVECEGQMNALSKARQYVEEFDGNIASFIFSGKPGTGKNHLAAAIC
NELLLRGKSVLIITVADIMSAMKDTFRNSGTSEEQLLNDLSNVDLLVIDEIGVQTESKYE
KVIINQIVDRRSSSKRPTGMLTNSNMEEMTKLLGERVMDRMRLGNSLWVIFNWDSYRSRV
TGKEY
              
                            

Download fasta file
RegulonDB