RegulonDB RegulonDB 10.9: Amino acid Sequence
membrane-bound lytic murein transglycosylase D Amino Acid Sequence


Size: 452

Fasta

 

>membrane-bound lytic murein transglycosylase D E. coli K12. Version NC_000913.3 GI:556503834
MKAKAILLASVLLVGCQSTGNVQQHAQSLSAAGQGEAAKFTSQARWMDDGTSIAPDGDLW
AFIGDELKMGIPENDRIREQKQKYLRNKSYLHDVTLRAEPYMYWIAGQVKKRNMPMELVL
LPIVESAFDPHATSGANAAGIWQIIPSTGRNYGLKQTRNYDARRDVVASTTAALNMMQRL
NKMFDGDWLLTVAAYNSGEGRVMKAIKTNKARGKSTDFWSLPLPQETKQYVPKMLALSDI
LKNSKRYGVRLPTTDESRALARVHLSSPVEMAKVADMAGISVSKLKTFNAGVKGSTLGAS
GPQYVMVPKKHADQLRESLASGEIAAVQSTLVADNTPLNSRVYTVRSGDTLSSIASRLGV
STKDLQQWNKLRGSKLKPGQSLTIGAGSSAQRLANNSDSITYRVRKGDSLSSIAKRHGVN
IKDVMRWNSDTANLQPGDKLTLFVKNNNMPDS
              
                            

Download fasta file
RegulonDB