RegulonDB RegulonDB 10.10: Amino acid Sequence
2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase Amino Acid Sequence


Size: 248

Fasta

 

>2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase E. coli K12. Version NC_000913.3 GI:556503834
MDFSGKNVWVTGAGKGIGYATALAFVEAGAKVTGFDQAFTQEQYPFATEVMDVADAAQVA
QVCQRLLAETERLDALVNAAGILRMGATDQLSKEDWQQTFAVNVGGAFNLFQQTMNQFRR
QRGGAIVTVASDAAHTPRIGMSAYGASKAALKSLALSVGLELAGSGVRCNVVSPGSTDTD
MQRTLWVSDDAEEQRIRGFGEQFKLGIPLGKIARPQEIANTILFLASDLASHITLQDIVV
DGGSTLGA
              
                            

Download fasta file
RegulonDB