RegulonDB RegulonDB 10.9: Amino acid Sequence
long-chain fatty acid outer membrane channel / bacteriophage T2 receptor Amino Acid Sequence


Size: 446

Fasta

 

>long-chain fatty acid outer membrane channel / bacteriophage T2 receptor E. coli K12. Version NC_000913.3 GI:556503834
MSQKTLFTKSALAVAVALISTQAWSAGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPA
LITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWG
ASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKI
ERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILY
ELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMW
EVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYY
DDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSV
KINEGPYQFESEGKAWLFGTNFNYAF
              
                            

Download fasta file
RegulonDB