RegulonDB RegulonDB 10.9: Amino acid Sequence
ferric citrate ABC transporter membrane subunit FecD Amino Acid Sequence


Size: 318

Fasta

 

>ferric citrate ABC transporter membrane subunit FecD E. coli K12. Version NC_000913.3 GI:556503834
MKIALVIFITLALAGCALLSLHMGVIPVPWRALLTDWQAGHEHYYVLMEYRLPRLLLALF
VGAALAVAGVLIQGIVRNPLASPDILGVNHAASLASVGALLLMPSLPVMVLPLLAFAGGM
AGLILLKMLAKTHQPMKLALTGVALSACWASLTDYLMLSRPQDVNNALLWLTGSLWGRDW
SFVKIAIPLMILFLPLSLSFCRDLDLLALGDARATTLGVSVPHTRFWALLLAVAMTSTGV
AACGPISFIGLVVPHMMRSITGGRHRRLLPVSALTGALLLVVADLLARIIHPPLELPVGV
LTAIIGAPWFVWLLVRMR
              
                            

Download fasta file
RegulonDB