RegulonDB RegulonDB 10.8: Amino acid Sequence
flagellar motor switch protein FliM Amino Acid Sequence


Size: 334

Fasta

 

>flagellar motor switch protein FliM E. coli K12. Version NC_000913.3 GI:556503834
MGDSILSQAEIDALLNGDSEVKDEPTASVSGESDIRPYDPNTQRRVVRERLQALEIINER
FARHFRMGLFNLLRRSPDITVGAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSP
SLVFIAVDNLFGGDGRFPTKVEGREFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYV
RSEMQVKFTNITTSPNDIVVNTPFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSR
NEDQNWRDNLVRQVQHSQLELVANFADISLRLSQILKLNPGDVLPIEKPDRIIAHVDGVP
VLTSQYGTLNGQYALRIEHLINPILNSLNEEQPK
              
                            

Download fasta file
RegulonDB