RegulonDB RegulonDB 11.0: Amino acid Sequence
ribosome-recycling factor Amino Acid Sequence


Size: 185

Fasta

 

>ribosome-recycling factor E. coli K12. Version NC_000913.3 GI:556503834
MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVE
DSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGE
AEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEA
ELMQF
              
                            

Download fasta file
RegulonDB