RegulonDB RegulonDB 10.9: Amino acid Sequence
1-phosphofructokinase Amino Acid Sequence


Size: 312

Fasta

 

>1-phosphofructokinase E. coli K12. Version NC_000913.3 GI:556503834
MSRRVATITLNPAYDLVGFCPEIERGEVNLVKTTGLHAAGKGINVAKVLKDLGIDVTVGG
FLGKDNQDGFQQLFSELGIANRFQVVQGRTRINVKLTEKDGEVTDFNFSGFEVTPADWER
FVTDSLSWLGQFDMVCVSGSLPSGVSPEAFTDWMTRLRSQCPCIIFDSSREALVAGLKAA
PWLVKPNRRELEIWAGRKLPEMKDVIEAAHALREQGIAHVVISLGAEGALWVNASGEWIA
KPPSVDVVSTVGAGDSMVGGLIYGLLMRESSEHTLRLATAVAALAVSQSNVGITDRPQLA
AMMARVDLQPFN
              
                            

Download fasta file
RegulonDB