RegulonDB RegulonDB 10.8: Amino acid Sequence
16S rRNA m7G527 methyltransferase Amino Acid Sequence


Size: 207

Fasta

 

>16S rRNA m7G527 methyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MLNKLSLLLKDAGISLTDHQKNQLIAYVNMLHKWNKAYNLTSVRDPNEMLVRHILDSIVV
APYLQGERFIDVGTGPGLPGIPLSIVRPEAHFTLLDSLGKRVRFLRQVQHELKLENIEPV
QSRVEEFPSEPPFDGVISRAFASLNDMVSWCHHLPGEQGRFYALKGQMPEDEIALLPEEY
QVESVVKLQVPALDGERHLVVIKANKI
              
                            

Download fasta file
RegulonDB