RegulonDB RegulonDB 10.9: Amino acid Sequence
xanthine-guanine phsophoribosyltransferase Amino Acid Sequence


Size: 152

Fasta

 

>xanthine-guanine phsophoribosyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MSEKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVCI
SSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRP
LVDDYVVDIPQDTWIEQPWDMGVVFVPPISGR
              
                            

Download fasta file
RegulonDB