RegulonDB RegulonDB 10.9: Amino acid Sequence
nucleotide exchange factor GrpE Amino Acid Sequence


Size: 197

Fasta

 

>nucleotide exchange factor GrpE E. coli K12. Version NC_000913.3 GI:556503834
MSSKEQKTPEGQAPEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERD
GILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMV
EGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTL
NGRTIRAAMVTVAKAKA
              
                            

Download fasta file
RegulonDB