RegulonDB RegulonDB 10.9: Amino acid Sequence
reduced glutaredoxin 1 Amino Acid Sequence


Size: 85

Fasta

 

>reduced glutaredoxin 1 E. coli K12. Version NC_000913.3 GI:556503834
MQTVIFGRSGCPYCVRAKDLAEKLSNERDDFQYQYVDIRAEGITKEDLQQKAGKPVETVP
QIFVDQQHIGGYTDFAAWVKENLDA
              
                            

Download fasta file
RegulonDB