RegulonDB RegulonDB 10.9: Amino acid Sequence
7-α-hydroxysteroid dehydrogenase Amino Acid Sequence


Size: 255

Fasta

 

>7-α-hydroxysteroid dehydrogenase E. coli K12. Version NC_000913.3 GI:556503834
MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGG
QAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVF
SFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEK
NIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVS
GQILTVSGGGVQELN
              
                            

Download fasta file
RegulonDB