RegulonDB RegulonDB 10.9: Amino acid Sequence
DNA helicase IV Amino Acid Sequence


Size: 684

Fasta

 

>DNA helicase IV E. coli K12. Version NC_000913.3 GI:556503834
MELKATTLGKRLAQHPYDRAVILNAGIKVSGDRHEYLIPFNQLLAIHCKRGLVWGELEFV
LPDEKVVRLHGTEWGETQRFYHHLDAHWRRWSGEMSEIASGVLRQQLDLIATRTGENKWL
TREQTSGVQQQIRQALSALPLPVNRLEEFDNCREAWRKCQAWLKDIESARLQHNQAYTEA
MLTEYADFFRQVESSPLNPAQARAVVNGEHSLLVLAGAGSGKTSVLVARAGWLLARGEAS
PEQILLLAFGRKAAEEMDERIRERLHTEDITARTFHALALHIIQQGSKKVPIVSKLENDT
AARHELFIAEWRKQCSEKKAQAKGWRQWLTEEMQWSVPEGNFWDDEKLQRRLASRLDRWV
SLMRMHGGAQAEMIASAPEEIRDLFSKRIKLMAPLLKAWKGALKAENAVDFSGLIHQAIV
ILEKGRFISPWKHILVDEFQDISPQRAALLAALRKQNSQTTLFAVGDDWQAIYRFSGAQM
SLTTAFHENFGEGERCDLDTTYRFNSRIGEVANRFIQQNPGQLKKPLNSLTNGDKKAVTL
LDESQLDALLDKLSGYAKPEERILILARYHHMRPASLEKAATRWPKLQIDFMTIHASKGQ
QADYVIIVGLQEGSDGFPAAARESIMEEALLPPVEDFPDAEERRLMYVALTRARHRVWAL
FNKENPSPFVEILKNLDVPVARKP
              
                            

Download fasta file
RegulonDB