RegulonDB RegulonDB 10.8: Amino acid Sequence
ferrochelatase Amino Acid Sequence


Size: 320

Fasta

 

>ferrochelatase E. coli K12. Version NC_000913.3 GI:556503834
MRQTKTGILLANLGTPDAPTPEAVKRYLKQFLSDRRVVDTSRLLWWPLLRGVILPLRSPR
VAKLYASVWMEGGSPLMVYSRQQQQALAQRLPEMPVALGMSYGSPSLESAVDELLAEHVD
HIVVLPLYPQFSCSTVGAVWDELARILARKRSIPGISFIRDYADNHDYINALANSVRASF
AKHGEPDLLLLSYHGIPQRYADEGDDYPQRCRTTTRELASALGMAPEKVMMTFQSRFGRE
PWLMPYTDETLKMLGEKGVGHIQVMCPGFAADCLETLEEIAEQNREVFLGAGGKKYEYIP
ALNATPEHIEMMANLVAAYR
              
                            

Download fasta file
RegulonDB