RegulonDB RegulonDB 10.9: Amino acid Sequence
haemolysin expression-modulating protein Hha Amino Acid Sequence


Size: 72

Fasta

 

>haemolysin expression-modulating protein Hha E. coli K12. Version NC_000913.3 GI:556503834
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLY
DKIPSSVWKFIR
              
                            

Download fasta file
RegulonDB