RegulonDB RegulonDB 10.8: Amino acid Sequence
integration host factor subunit α Amino Acid Sequence


Size: 99

Fasta

 

>integration host factor subunit α E. coli K12. Version NC_000913.3 GI:556503834
MALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQR
PGRNPKTGEDIPITARRVVTFRPGQKLKSRVENASPKDE
              
                            

Download fasta file
RegulonDB