RegulonDB RegulonDB 10.9: Amino acid Sequence
imidazole glycerol phosphate synthase subunit HisH Amino Acid Sequence


Size: 196

Fasta

 

>imidazole glycerol phosphate synthase subunit HisH E. coli K12. Version NC_000913.3 GI:556503834
MNVVILDTGCANLNSVKSAIARHGYEPKVSRDPDVVLLADKLFLPGVGTAQAAMDQVRER
ELFDLIKACTQPVLGICLGMQLLGRRSEESNGVDLLGIIDEDVPKMTDFGLPLPHMGWNR
VYPQAGNRLFQGIEDGAYFYFVHSYAMPVNPWTIAQCNYGEPFTAAVQKDNFYGVQFHPE
RSGAAGAKLLKNFLEM
              
                            

Download fasta file
RegulonDB