RegulonDB RegulonDB 11.0: Amino acid Sequence
lauroyl acyltransferase Amino Acid Sequence


Size: 306

Fasta

 

>lauroyl acyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MTNLPKFSTALLHPRYWLTWLGIGVLWLVVQLPYPVIYRLGCGLGKLALRFMKRRAKIVH
RNLELCFPEMSEQERRKMVVKNFESVGMGLMETGMAWFWPDRRIARWTEVIGMEHIRDVQ
AQKRGILLVGIHFLTLELGARQFGMQEPGIGVYRPNDNPLIDWLQTWGRLRSNKSMLDRK
DLKGMIKALKKGEVVWYAPDHDYGPRSSVFVPLFAVEQAATTTGTWMLARMSGACLVPFV
PRRKPDGKGYQLIMLPPECSPPLDDAETTAAWMNKVVEKCIMMAPEQYMWLHRRFKTRPE
GVPSRY
              
                            

Download fasta file
RegulonDB