RegulonDB RegulonDB 10.8: Amino acid Sequence
hydrogenase 1 cytochrome b subunit Amino Acid Sequence


Size: 235

Fasta

 

>hydrogenase 1 cytochrome b subunit E. coli K12. Version NC_000913.3 GI:556503834
MQQKSDNVVSHYVFEAPVRIWHWLTVLCMAVLMVTGYFIGKPLPSVSGEATYLFYMGYIR
LIHFSAGMVFTVVLLMRIYWAFVGNRYSRELFIVPVWRKSWWQGVWYEIRWYLFLAKRPS
ADIGHNPIAQAAMFGYFLMSVFMIITGFALYSEHSQYAIFAPFRYVVEFFYWTGGNSMDI
HSWHRLGMWLIGAFVIGHVYMALREDIMSDDTVISTMVNGYRSHKFGKISNKERS
              
                            

Download fasta file
RegulonDB