RegulonDB RegulonDB 10.9: Amino acid Sequence
putative hydrogenase 1 maturation protease HyaD Amino Acid Sequence


Size: 195

Fasta

 

>putative hydrogenase 1 maturation protease HyaD E. coli K12. Version NC_000913.3 GI:556503834
MSEQRVVVMGLGNLLWADEGFGVRVAERLYAHYHWPEYVEIVDGGTQGLNLLGYVESASH
LLILDAIDYGLEPGTLRTYAGERIPAYLSAKKMSLHQNSFSEVLALADIRGHLPAHIALV
GLQPAMLDDYGGSLSELAREQLPAAEQAALAQLAAWGIVPQPANESRCLNYDCLSMENYE
GVRLRQYRMTQEEQG
              
                            

Download fasta file
RegulonDB