RegulonDB RegulonDB 10.9: Amino acid Sequence
RNA polymerase, sigma S (sigma 38) factor Amino Acid Sequence


Size: 330

Fasta

 

>RNA polymerase, sigma S (sigma 38) factor E. coli K12. Version NC_000913.3 GI:556503834
MSQNTLKVHDLNEDAEFDENGVEVFDEKALVEQEPSDNDLAEEELLSQGATQRVLDATQL
YLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLVVKIARRYGNRGLALLDLI
EEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRLPIHIVKELNVYLR
TARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNERITSVDTPLGGDSEKALLDILAD
EKENGPEDTTQDDDMKQSIVKWLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRE
RVRQIQVEGLRRLREILQTQGLNIEALFRE
              
                            

Download fasta file
RegulonDB