RegulonDB RegulonDB 10.9: Amino acid Sequence
3-deoxy-manno-octulosonate cytidylyltransferase Amino Acid Sequence


Size: 248

Fasta

 

>3-deoxy-manno-octulosonate cytidylyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MSFVVIIPARYASTRLPGKPLVDINGKPMIVHVLERARESGAERIIVATDHEDVARAVEA
AGGEVCMTRADHQSGTERLAEVVEKCAFSDDTVIVNVQGDEPMIPATIIRQVADNLAQRQ
VGMATLAVPIHNAEEAFNPNAVKVVLDAEGYALYFSRATIPWDRDRFAEGLETVGDNFLR
HLGIYGYRAGFIRRYVNWQPSPLEHIEMLEQLRVLWYGEKIHVAVAQEVPGTGVDTPEDL
ERVRAEMR
              
                            

Download fasta file
RegulonDB