RegulonDB RegulonDB 10.9: Amino acid Sequence
α-ketoglutarate:H+ symporter Amino Acid Sequence


Size: 432

Fasta

 

>α-ketoglutarate:H+ symporter E. coli K12. Version NC_000913.3 GI:556503834
MAESTVTADSKLTSSDTRRRIWAIVGASSGNLVEWFDFYVYSFCSLYFAHIFFPSGNTTT
QLLQTAGVFAAGFLMRPIGGWLFGRIADKHGRKKSMLLSVCMMCFGSLVIACLPGYETIG
TWAPALLLLARLFQGLSVGGEYGTSATYMSEVAVEGRKGFYASFQYVTLIGGQLLALLVV
VVLQHTMEDAALREWGWRIPFALGAVLAVVALWLRRQLDETSQQETRALKEAGSLKGLWR
NRRAFIMVLGFTAAGSLCFYTFTTYMQKYLVNTAGMHANVASGIMTAALFVFMLIQPLIG
ALSDKIGRRTSMLCFGSLAAIFTVPILSALQNVSSPYAAFGLVMCALLIVSFYTSISGIL
KAEMFPAQVRALGVGLSYAVANAIFGGSAEYVALSLKSIGMETAFFWYVTLMAVVAFLVS
LMLHRKGKGMRL
              
                            

Download fasta file
RegulonDB