RegulonDB RegulonDB 10.9: Amino acid Sequence
DNA-binding transcriptional dual regulator LeuO Amino Acid Sequence


Size: 314

Fasta

 

>DNA-binding transcriptional dual regulator LeuO E. coli K12. Version NC_000913.3 GI:556503834
MPEVQTDHPETAELSKPQLRMVDLNLLTVFDAVMQEQNITRAAHVLGMSQPAVSNAVARL
KVMFNDELFVRYGRGIQPTARAFQLFGSVRQALQLVQNELPGSGFEPASSERVFHLCVCS
PLDSILTSQIYNHIEQIAPNIHVMFKSSLNQNTEHQLRYQETEFVISYEDFHRPEFTSVP
LFKDEMVLVASKNHPTIKGPLLKHDVYNEQHAAVSLDRFASFSQPWYDTVDKQASIAYQG
MAMMSVLSVVSQTHLVAIAPRWLAEEFAESLELQVLPLPLKQNSRTCYLSWHEAAGRDKG
HQWMEEQLVSICKR
              
                            

Download fasta file
RegulonDB