RegulonDB RegulonDB 10.10: Amino acid Sequence
acyl-[acyl-carrier-protein]—UDP-N-acetylglucosamine O-acyltransferase Amino Acid Sequence


Size: 262

Fasta

 

>UDP-N-acetylglucosamine acyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MIDKSAFVHPTAIVEEGASIGANAHIGPFCIVGPHVEIGEGTVLKSHVVVNGHTKIGRDN
EIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTVQGGGLTKVGSDNLLMIN
AHIAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQFCIIGAHVMVGGCSGVAQD
VPPYVIAQGNHATPFGVNIEGLKRRGFSREAITAIRNAYKLIYRSGKTLDEVKPEIAELA
ETYPEVKAFTDFFARSTRGLIR
              
                            

Download fasta file
RegulonDB