RegulonDB RegulonDB 10.9: Amino acid Sequence
mannose-specific PTS enzyme IIAB component Amino Acid Sequence


Size: 323

Fasta

 

>mannose-specific PTS enzyme IIAB component E. coli K12. Version NC_000913.3 GI:556503834
MTIAIVIGTHGWAAEQLLKTAEMLLGEQENVGWIDFVPGENAETLIEKYNAQLAKLDTTK
GVLFLVDTWGGSPFNAASRIVVDKEHYEVIAGVNIPMLVETLMARDDDPSFDELVALAVE
TGREGVKALKAKPVEKAAPAPAAAAPKAAPTPAKPMGPNDYMVIGLARIDDRLIHGQVAT
RWTKETNVSRIIVVSDEVAADTVRKTLLTQVAPPGVTAHVVDVAKMIRVYNNPKYAGERV
MLLFTNPTDVERLVEGGVKITSVNVGGMAFRQGKTQVNNAVSVDEKDIEAFKKLNARGIE
LEVRKVSTDPKLKMMDLISKIDK
              
                            

Download fasta file
RegulonDB