RegulonDB RegulonDB 10.10: Amino acid Sequence
O-succinylhomoserine(thiol)-lyase / O-succinylhomoserine lyase Amino Acid Sequence


Size: 386

Fasta

 

>O-succinylhomoserine(thiol)-lyase / O-succinylhomoserine lyase E. coli K12. Version NC_000913.3 GI:556503834
MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRA
LAELEGGAGAVLTNTGMSAIHLVTTVFLKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVL
FVDQGDEQALRAALAEKPKLVLVESPSNPLLRVVDIAKICHLAREVGAVSVVDNTFLSPA
LQNPLALGADLVLHSCTKYLNGHSDVVAGVVIAKDPDVVTELAWWANNIGVTGGAFDSYL
LLRGLRTLVPRMELAQRNAQAIVKYLQTQPLVKKLYHPSLPENQGHEIAARQQKGFGAML
SFELDGDEQTLRRFLGGLSLFTLAESLGGVESLISHAATMTHAGMAPEARAAAGISETLL
RISTGIEDGEDLIADLENGFRAANKG
              
                            

Download fasta file
RegulonDB