RegulonDB RegulonDB 10.10: Amino acid Sequence
cystathionine β-lyase / L-cysteine desulfhydrase / alanine racemase Amino Acid Sequence


Size: 395

Fasta

 

>cystathionine β-lyase / L-cysteine desulfhydrase E. coli K12. Version NC_000913.3 GI:556503834
MADKKLDTQLVNAGRSKKYTLGAVNSVIQRASSLVFDSVEAKKHATRNRANGELFYGRRG
TLTHFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFIEQGDHVLMTNTAYEPSQDFCSK
ILSKLGVTTSWFDPLIGADIVKHLQPNTKIVFLESPGSITMEVHDVPAIVAAVRSVVPDA
IIMIDNTWAAGVLFKALDFGIDVSIQAATKYLVGHSDAMIGTAVCNARCWEQLRENAYLM
GQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGSKGHEFW
KRDFTGSSGLFSFVLKKKLNNEELANYLDNFSLFSMAYSWGGYESLILANQPEHIAAIRP
QGEIDFSGTLIRLHIGLEDVDDLIADLDAGFARIV
              
                            

Download fasta file
RegulonDB