RegulonDB RegulonDB 10.10: Amino acid Sequence
Z-ring positioning protein MinE Amino Acid Sequence


Size: 88

Fasta

 

>Z-ring positioning protein MinE E. coli K12. Version NC_000913.3 GI:556503834
MALLDFFLSRKKNTANIAKERLQIIVAERRRSDAEPHYLPQLRKDILEVICKYVQIDPEM
VTVQLEQKDGDISILELNVTLPEAEELK
              
                            

Download fasta file
RegulonDB