RegulonDB RegulonDB 10.9: Amino acid Sequence
P-loop NTPase family protein Mrp Amino Acid Sequence


Size: 369

Fasta

 

>P-loop NTPase family protein Mrp E. coli K12. Version NC_000913.3 GI:556503834
MNEQSQAKSPEALRAMVAGTLANFQHPTLKHNLTTLKALHHVAWMDDTLHVELVMPFVWH
SAFEELKEQCSAELLRITGAKAIDWKLSHNIATLKRVKNQPGINGVKNIIAVSSGKGGVG
KSSTAVNLALALAAEGAKVGILDADIYGPSIPTMLGAENQRPTSPDGTHMAPIMSHGLAT
NSIGYLVTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDMPPGTGDIQLTLAQNIPV
TGAVVVTTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSVHICSNCGHHEPIFGTGGAEK
LAEKYHTQLLGQMPLHISLREDLDKGTPTVISRPESEFTAIYRQLADRVAAQLYWQGEVI
PGEISFRAV
              
                            

Download fasta file
RegulonDB