RegulonDB RegulonDB 10.9: Amino acid Sequence
DLP12 prophage; multidrug/betaine/choline efflux transporter EmrE Amino Acid Sequence


Size: 110

Fasta

 

>multidrug/betaine/choline efflux transporter EmrE E. coli K12. Version NC_000913.3 GI:556503834
MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAY
AIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLSRSTPH
              
                            

Download fasta file
RegulonDB