RegulonDB RegulonDB 10.9: Amino acid Sequence
N-acetylglucosamine-6-phosphate deacetylase Amino Acid Sequence


Size: 382

Fasta

 

>N-acetylglucosamine-6-phosphate deacetylase E. coli K12. Version NC_000913.3 GI:556503834
MYALTQGRIFTGHEFLDDHAVVIADGLIKSVCPVAELPPEIEQRSLNGAILSPGFIDVQL
NGCGGVQFNDTAEAVSVETLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAK
HPNQALGLHLEGPWLNLVKKGTHNPNFVRKPDAALVDFLCENADVITKVTLAPEMVPAEV
ISKLANAGIVVSAGHSNATLKEAKAGFRAGITFATHLYNAMPYITGREPGLAGAILDEAD
IYCGIIADGLHVDYANIRNAKRLKGDKLCLVTDATAPAGANIEQFIFAGKTIYYRNGLCV
DENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANL
TAFTPDFKITKTIVNGNEVVTQ
              
                            

Download fasta file
RegulonDB