RegulonDB RegulonDB 10.9: Amino acid Sequence
UMP phosphatase Amino Acid Sequence


Size: 250

Fasta

 

>UMP phosphatase E. coli K12. Version NC_000913.3 GI:556503834
MTIKNVICDIDGVLMHDNVAVPGAAEFLHGIMDKGLPLVLLTNYPSQTGQDLANRFATAG
VDVPDSVFYTSAMATADFLRRQEGKKAYVVGEGALIHELYKAGFTITDVNPDFVIVGETR
SYNWDMMHKAAYFVANGARFIATNPDTHGRGFYPACGALCAGIEKISGRKPFYVGKPSPW
IIRAALNKMQAHSEETVIVGDNLRTDILAGFQAGLETILVLSGVSSLDDIDSMPFRPSWI
YPSVAEIDVI
              
                            

Download fasta file
RegulonDB