RegulonDB RegulonDB 10.9: Amino acid Sequence
nitrate reductase 1 molybdenum cofactor assembly chaperone Amino Acid Sequence


Size: 236

Fasta

 

>nitrate reductase 1 molybdenum cofactor assembly chaperone E. coli K12. Version NC_000913.3 GI:556503834
MIELVIVSRLLEYPDAALWQHQQEMFEAIAASKNLPKEDAHALGIFLRDLTTMDPLDAQA
QYSELFDRGRATSLLLFEHVHGESRDRGQAMVDLLAQYEQHGLQLNSRELPDHLPLYLEY
LAQLPQSEAVEGLKDIAPILALLSARLQQRESRYAVLFDLLLKLANTAIDSDKVAEKIAD
EARDDTPQALDAVWEEEQVKFFADKGCGDSAITAHQRRFAGAVAPQYLNITTGGQH
              
                            

Download fasta file
RegulonDB