RegulonDB RegulonDB 10.9: Amino acid Sequence
nucleoside diphosphate kinase Amino Acid Sequence


Size: 143

Fasta

 

>nucleoside diphosphate kinase E. coli K12. Version NC_000913.3 GI:556503834
MAIERTFSIIKPNAVAKNVIGNIFARFEAAGFKIVGTKMLHLTVEQARGFYAEHDGKPFF
DGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPANALAGTLRADYADSLTENGTHGSD
SVESAAREIAYFFGEGEVCPRTR
              
                            

Download fasta file
RegulonDB