RegulonDB RegulonDB 11.1: Amino acid Sequence
nitrite transporter NirC Amino Acid Sequence


Size: 268

Fasta

 

>nitrite transporter NirC E. coli K12. Version NC_000913.3 GI:556503834
MFTDTINKCAANAARIARLSANNPLGFWVSSAMAGAYVGLGIILIFTLGNLLDPSVRPLV
MGATFGIALTLVIIAGSELFTGHTMFLTFGVKAGSISHGQMWAILPQTWLGNLVGSVFVA
MLYSWGGGSLLPVDTSIVHSVALAKTTAPAMVLFFKGALCNWLVCLAIWMALRTEGAAKF
IAIWWCLLAFIASGYEHSIANMTLFALSWFGNHSEAYTLAGIGHNLLWVTLGNTLSGAVF
MGLGYWYATPKANRPVADKFNQTETAAG
              
                            

Download fasta file
RegulonDB