RegulonDB RegulonDB 10.10: Amino acid Sequence
NH3-dependent NAD+ synthetase Amino Acid Sequence


Size: 275

Fasta

 

>NAD synthetase, NH3-dependent E. coli K12. Version NC_000913.3 GI:556503834
MTLQQQIIKALGAKPQINAEEEIRRSVDFLKSYLQTYPFIKSLVLGISGGQDSTLAGKLC
QMAINELRLETGNESLQFIAVRLPYGVQADEQDCQDAIAFIQPDRVLTVNIKGAVLASEQ
ALREAGIELSDFVRGNEKARERMKAQYSIAGMTSGVVVGTDHAAEAITGFFTKYGDGGTD
INPLYRLNKRQGKQLLAALACPEHLYKKAPTADLEDDRPSLPDEVALGVTYDNIDDYLEG
KNVPQQVARTIENWYLKTEHKRRPPITVFDDFWKK
              
                            

Download fasta file
RegulonDB