RegulonDB RegulonDB 10.9: Amino acid Sequence
methylated-DNA—[protein]-cysteine S-methyltransferase Amino Acid Sequence


Size: 171

Fasta

 

>methylated-DNA—[protein]-cysteine S-methyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MLRLLEEKIATPLGPLWVICDEQFRLRAVEWEEYSERMVQLLDIHYRKEGYERISATNPG
GLSDKLREYFAGNLSIIDTLPTATGGTPFQREVWKTLRTIPCGQVMHYGQLAEQLGRPGA
ARAVGAANGSNPISIVVPCHRVIGRNGTMTGYAGGVQRKEWLLRHEGYLLL
              
                            

Download fasta file
RegulonDB