RegulonDB RegulonDB 10.9: Amino acid Sequence
DLP12 prophage; protease 7 Amino Acid Sequence


Size: 317

Fasta

 

>outer membrane protease VII (outer membrane protein 3b) E. coli K12. Version NC_000913.3 GI:556503834
MRAKLLGIVLTTPIAISSFASTETLSFTPDNINADISLGTLSGKTKERVYLAEEGGRKVS
QLDWKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRGGNMVDQDWMDSSNPGTWTDESR
HPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTARGGSYIYSSEEGFRDDI
GSFPNGERAIGYKQRFKMPYIGLTGSYRYEDFELGGTFKYSGWVESSDNDEHYDPGKRIT
YRSKVKDQNYYSVAVNAGYYVTPNAKVYVEGAWNRVTNKKGNTSLYDHNNNTSDYSKNGA
GIENYNFITTAGLKYTF
              
                            

Download fasta file
RegulonDB