RegulonDB RegulonDB 10.9: Amino acid Sequence
murein tripeptide ABC transporter / oligopeptide ABC transporter ATP binding subunit OppD Amino Acid Sequence


Size: 337

Fasta

 

>murein tripeptide ABC transporter / oligopeptide ABC transporter ATP binding subunit OppD E. coli K12. Version NC_000913.3 GI:556503834
MSVIETATVPLAQQQADALLNVKDLRVTFSTPDGDVTAVNDLNFSLRAGETLGIVGESGS
GKSQTAFALMGLLAANGRIGGSATFNGREILNLPEHELNKLRAEQISMIFQDPMTSLNPY
MRVGEQLMEVLMLHKNMSKAEAFEESVRMLDAVKMPEARKRMKMYPHEFSGGMRQRVMIA
MALLCRPKLLIADEPTTALDVTVQAQIMTLLNELKREFNTAIIMITHDLVVVAGICDKVL
VMYAGRTMEYGNARDVFYQPVHPYSIGLLNAVPRLDAEGETMLTIPGNPPNLLRLPKGCP
FQPRCPHAMEICSSAPPLEEFTPGRLRACFKPVEELL
              
                            

Download fasta file
RegulonDB