RegulonDB RegulonDB 10.9: Amino acid Sequence
aminodeoxychorismate synthase subunit 2 Amino Acid Sequence


Size: 187

Fasta

 

>aminodeoxychorismate synthase subunit 2 E. coli K12. Version NC_000913.3 GI:556503834
MILLIDNYDSFTWNLYQYFCELGADVLVKRNDALTLADIDALKPQKIVISPGPCTPDEAG
ISLDVIRHYAGRLPILGVCLGHQAMAQAFGGKVVRAAKVMHGKTSPITHNGEGVFRGLAN
PLTVTRYHSLVVEPDSLPACFDVTAWSETREIMGIRHRQWDLEGVQFHPESILSEQGHQL
LANFLHR
              
                            

Download fasta file
RegulonDB