RegulonDB RegulonDB 11.1: Amino acid Sequence
protein-L-isoaspartate O-methyltransferase Amino Acid Sequence


Size: 208

Fasta

 

>L-isoaspartate protein carboxylmethyltransferase type II E. coli K12. Version NC_000913.3 GI:556503834
MVSRRVQALLDQLRAQGIQDEQVLNALAAVPREKFVDEAFEQKAWDNIALPIGQGQTISQ
PYMVARMTELLELTPQSRVLEIGTGSGYQTAILAHLVQHVCSVERIKGLQWQARRRLKNL
DLHNVSTRHGDGWQGWQARAPFDAIIVTAAPPEIPTALMTQLDEGGILVLPVGEEHQYLK
RVRRRGGEFIIDTVEAVRFVPLVKGELA
              
                            

Download fasta file
RegulonDB